Protein coding transcript 256171

• Transcript: Ll_transcript_50248
• CDS coordinates: 112-1365 (+)
• Peptide sequence: MDLPSLALILQSALSPIPDERKAAEQSLDQIQYAPQHLVRLLQIVVDNNCDMAVRQVASIHFKNFVGKNWSPHDPDAQQHKISPADKDIVRDHILMFVAQVPPLLRVQLGECLKTIIHSDYPEQCPRLLDWVKHNLQDQQVYAALFVLRILSRKYEFKSDEERTPVYHIVDETFPHLLNIFNSLVNVPNPSIEVADLIRLICKIFWSSIYLEIPKHLLDQNVFGGWMVLFLNVLERPVPLEGQPVDPELRKSWGWWKVKKWTVHILNRLYSRFGDLKLQNPENRVFAQMFQKLYAAKILDCHLNLLNVIRVGGYLPDRVINLVLQYLSNSVSKNSMYTVLQPRLDVLLFEVVFPLMCFNDNDQKLWDEDPHEYVRKGYDIIEDLYSPRTASMAFASELARQRGNDNLHKFLQFIVEIF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_50248

• Blastp: Importin beta-like SAD2 homolog from Arabidopsis with 73.75% of identity
• Blastx: Importin beta-like SAD2 homolog from Arabidopsis with 73.75% of identity
• Eggnog: Importin(COG5656)
• Kegg: Link to kegg annotations (AT3G59020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428158.1)
• Pfam: Importin-beta N-terminal domain (PF03810.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;