Transcript | Ll_transcript_301417 |
---|---|
CDS coordinates | 3-485 (+) |
Peptide sequence | PNIMAMVDDFFSSWDLSRGCNSSFIVLVPKTGSPQDLGDFRPISLVGCIHKIISKILAARLKVVIRSVISDSQTAFLQGRFILEGAVIANEVIDQAKKSSGNGCFVFKVDFEKAYDSVKCSFLLFMMEKIGFCFKWRNWIKLFIVQHNVGFGEWKPYFRVQ |
ORF Type | internal |
Blastp | Transposon TX1 uncharacterized 149 kDa protein from Xenopus with 25.53% of identity |
---|---|
Blastx | Transposon TX1 uncharacterized 149 kDa protein from Xenopus with 25.53% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429814.1) |
Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer