Protein coding transcript 256343

• Transcript: Ll_transcript_51628
• CDS coordinates: 493-1059 (+)
• Peptide sequence: MGCFLLLIRGTHSIKDTLTAVTGTVIPFHHSVVYQGGVSDLVLGYAHCGMVAAARWIAKLATPRLLEALRRHSDYEVKIVGHSLGGGTAALLTYILREQKELSMTTCVAFAPAACMTWELAESGNGFITSVINGADLVPTFSAASVDDLRSEVTASAWINDLRSQIEQTRILSTVYRSASALGSRLPSI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_51628

• Blastp: Sn1-specific diacylglycerol lipase alpha from Mus with 33.76% of identity
• Blastx: Sn1-specific diacylglycerol lipase alpha from Rattus with 30.46% of identity
• Eggnog: triglyceride lipase activity(ENOG410XRFI)
• Kegg: Link to kegg annotations (269060)
• CantataDB: Link to cantataDB annotations (CNT0001770)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430404.1)
• Pfam: Lipase (class 3) (PF01764.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;