Transcript | Ll_transcript_520772 |
---|---|
CDS coordinates | 113-499 (+) |
Peptide sequence | MSLVANEDFQHILRVLNTNVDGKQKIVFALTSIKGIGRRLANIACKKADVDMNKRAGELTAAELDNIMTVVANPRQFKIPDWFLNRKKDYKDGKFSQVVSNALDMKLRDDLERLKKIRSVKCFWSFFV* |
ORF Type | complete |
Blastp | 40S ribosomal protein S18 from Arabidopsis with 84.73% of identity |
---|---|
Blastx | 40S ribosomal protein S18 from Arabidopsis with 84.73% of identity |
Eggnog | Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits(COG0099) |
Kegg | Link to kegg annotations (AT1G22780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435035.1) |
Pfam | Ribosomal protein S13/S18 (PF00416.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer