Protein coding transcript 256361

• Transcript: Ll_transcript_50497
• CDS coordinates: 435-746 (+)
• Peptide sequence: MGPVSALKELCMMEGFGVRFQSLDAPASPNSSQKDAVYAQVEIDGQVFGKGTGLTWDEAKMQAAEKALGSLRSQNLQKQQGSPRFFSGQHYIMYNSVITWIAN*
• ORF Type: complete

Annotations of Ll_transcript_50497

• Blastp: RNA polymerase II C-terminal domain phosphatase-like 1 from Arabidopsis with 54.44% of identity
• Blastx: RNA polymerase II C-terminal domain phosphatase-like 1 from Arabidopsis with 44.39% of identity
• Eggnog: CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190)
• Kegg: Link to kegg annotations (AT4G21670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445655.1)
• Pfam: Double-stranded RNA binding motif (PF00035.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;