Protein coding transcript 256469

• Transcript: Ll_transcript_51864
• CDS coordinates: 3-869 (+)
• Peptide sequence: LLFFLAILKFTVHTKLFFRYMISSNMGEVASIFLTAALGIPEGLIPVQLLWVNLVTDGPPATALGFNPPDTDIMKKPPRNKDDSLINLWILFRYMVVGMYVGLATVGVFIIWYTHGSFLGVDLSGDGHTLVTYNQLANWGRCSTWNNFTVSPFTAGARVLSFDNDPCGYFHAGKVKATTLSLSVLVAIEMFNSLNALSEDGSLLTMPPWVNPWLLLAMLVSFSLHFLILYVPFLAQIFGIVPLSFNEWLLVLVVAFPVIIVDEMLKFVGRCTSESQTSQARRSKQKSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_51864

• Blastp: Calcium-transporting ATPase 1, endoplasmic reticulum-type from Arabidopsis with 78.55% of identity
• Blastx: Calcium-transporting ATPase 1, endoplasmic reticulum-type from Arabidopsis with 78.55% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT1G07810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443028.1)
• Pfam: Cation transporting ATPase, C-terminus (PF00689.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;