Protein coding transcript 256488

• Transcript: Ll_transcript_51827
• CDS coordinates: 2600-3298 (+)
• Peptide sequence: MNSILNIHDVPNIWHIPLLLRNQNAHHSILQQLNLLSNATPPDLQRWTEMAESYDNLTESVRIAMVGKYVGLTDSYLSVVKALLHACVARSLRPSIDWIAASDLEDESAKSTPEGHAAAWETLKSAACVLVPGGFGDRGVKGMMLAAKYARENNVPYLGICLGMQISVIEFARSVLGWERANSVEFDAQTPNPVVIFMPEGSRTHMGSTMRLGSRRTFLKAPDSITSKLYVT*
• ORF Type: complete

Annotations of Ll_transcript_51827

• Blastp: CTP synthase from Dictyostelium with 49.59% of identity
• Blastx: CTP synthase from Dictyostelium with 78.11% of identity
• Eggnog: Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen (By similarity)(COG0504)
• Kegg: Link to kegg annotations (DDB_G0280567)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441312.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;