Protein coding transcript 2565

• Transcript: Ll_transcript_301413
• CDS coordinates: 462-1232 (+)
• Peptide sequence: MVMMKHMFFALPLVLVICCYSTTILAQSPAAAPAAPDEALAPSTPPTDIIRILQKAGGFTTLIRLLKITQVSTQINSQLLNSNGGLTFFAPNDNAFSSLKPGLLNSLNDQQKNELIQFHLLPTFVSTTDFATLSNPVRTQAGENPDRLALNVTSSGNQVNFTTGIVNATLGGTVYTDHQLAVYQVDKVLLPRDFFVAKTPAPAPAPEKTKASKKKSAEGPAVPAADDDSAAVTVKQFNGMFVSIAATIVAVATFLL*
• ORF Type: complete

Annotations of Ll_transcript_301413

• Blastp: Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 56.19% of identity
• Blastx: Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 62.5% of identity
• Eggnog: Arabinogalactan protein(ENOG410YFHZ)
• Kegg: Link to kegg annotations (AT5G03170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448724.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;