Protein coding transcript 256551

• Transcript: Ll_transcript_51110
• CDS coordinates: 189-587 (+)
• Peptide sequence: MGASMMIAEATLKEIECTRTVNQDQIWTLRFIFGKNLEGASRILDQRGVTRITAEPSGRVIFQVTGESRRKDKYVCFPENFCACYSFFYDVVKRAEQLCCKHQIATKLAASLGVCVEAKVSDEELALLLSKI*
• ORF Type: complete

Annotations of Ll_transcript_51110

• Blastp: Zinc finger SWIM domain-containing protein 7 from Danio with 37.23% of identity
• Blastx: Zinc finger SWIM domain-containing protein 7 from Danio with 37.98% of identity
• Eggnog: zinc finger, SWIM-type containing 7(ENOG4112D11)
• Kegg: Link to kegg annotations (325530)
• CantataDB: Link to cantataDB annotations (CNT0001714)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437243.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;