Protein coding transcript 256552

• Transcript: Ll_transcript_51111
• CDS coordinates: 1552-2160 (-)
• Peptide sequence: MHYFYLCAGGLMYKHPDSNLQYVTSITFLLTTYSKYMAATKHTFKCGNLVVDPNTIRRVAKRQVSVSFLSTFVRLIFSSPLLITWLTKFVLNFKVDYILGENPLEMSYMVGYGPNFPKRIHHRGSSLPSIASHPQSIGCQGGFDSFFYSANPNPNILVGAIVGGPNQNDAFPDLREDYSHSEPATYINGAFVGPLAYFAGIH*
• ORF Type: complete

Annotations of Ll_transcript_51111

• Blastp: Endoglucanase 9 from Arabidopsis with 63.02% of identity
• Blastx: Endoglucanase 9 from Arabidopsis with 63.02% of identity
• Eggnog: endo-glucanase(ENOG410YA4V)
• Kegg: Link to kegg annotations (AT1G71380)
• CantataDB: Link to cantataDB annotations (CNT0001714)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437242.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;