Transcript | Ll_transcript_51103 |
---|---|
CDS coordinates | 71-469 (+) |
Peptide sequence | MGASMMIAEATLKEIECTRTVNQDQIWTLRFIFGKNLEGASRILDQRGVTRITAEPSGRVIFQVTGESRRKDKYVCFPENFCACYSFFYDVVKRAEQLCCKHQIATKLAASLGVCVEAKVSDEELALLLSKI* |
ORF Type | complete |
Blastp | Zinc finger SWIM domain-containing protein 7 from Danio with 37.23% of identity |
---|---|
Blastx | Zinc finger SWIM domain-containing protein 7 from Danio with 37.98% of identity |
Eggnog | zinc finger, SWIM-type containing 7(ENOG4112D11) |
Kegg | Link to kegg annotations (325530) |
CantataDB | Link to cantataDB annotations (CNT0001714) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437243.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer