Protein coding transcript 256568

• Transcript: Ll_transcript_51001
• CDS coordinates: 505-1086 (+)
• Peptide sequence: MISVFLSIQLVDNVPILQIDIVWCYFMIRDIRWLADAGKRLEMARAGIERAHGKDLLRLRLLQGGRYPELALHLRLELLEGVVAYHNGQLEKSRKALASAKAKFVKLQVSDEALSFVMSMGFGEREAKRALRMNNQDVSSAIDFLAEEKTKKRQQQEEDIRRRDEIKEQKRYGMTPSKKAVDIERLNELVSIG*
• ORF Type: complete

Annotations of Ll_transcript_51001

• Blastp: NEDD8 ultimate buster 1 from Mus with 33.81% of identity
• Blastx: NEDD8 ultimate buster 1 from Mus with 33.81% of identity
• Eggnog: Negative regulator of ubiquitin-like proteins 1(ENOG410ZK3P)
• Kegg: Link to kegg annotations (53312)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415629.1)
• Pfam: UBA/TS-N domain (PF00627.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;