Protein coding transcript 256580

• Transcript: Ll_transcript_49843
• CDS coordinates: 182-574 (+)
• Peptide sequence: MEGERLDFGKMGYGCKHYRRRCRIRAPCCNEIYSCRHCHNDATSMLKNPSDHHDLVRQDVKQVICSVCDTEHEVAQVCTNCGVKMGEYFCNICKFFDDDTEKEQFHCDDCGICRVGGRENYFHCKKCGMH*
• ORF Type: complete

Annotations of Ll_transcript_49843

• Blastp: E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 79.37% of identity
• Blastx: E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 83.21% of identity
• Eggnog: ring finger and CHY zinc finger(ENOG410XXHF)
• Kegg: Link to kegg annotations (AT5G18650)
• CantataDB: Link to cantataDB annotations (CNT0000793)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450860.1)
• Pfam: CHY zinc finger (PF05495.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;