Transcript | Ll_transcript_49843 |
---|---|
CDS coordinates | 182-574 (+) |
Peptide sequence | MEGERLDFGKMGYGCKHYRRRCRIRAPCCNEIYSCRHCHNDATSMLKNPSDHHDLVRQDVKQVICSVCDTEHEVAQVCTNCGVKMGEYFCNICKFFDDDTEKEQFHCDDCGICRVGGRENYFHCKKCGMH* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 79.37% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 83.21% of identity |
Eggnog | ring finger and CHY zinc finger(ENOG410XXHF) |
Kegg | Link to kegg annotations (AT5G18650) |
CantataDB | Link to cantataDB annotations (CNT0000793) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450860.1) |
Pfam | CHY zinc finger (PF05495.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer