Protein coding transcript 256588

• Transcript: Ll_transcript_49862
• CDS coordinates: 184-1074 (+)
• Peptide sequence: MESSANEERLHFGNMEYGYFSFLHASFLFFFQLSFFCFFFHLFSIYSCKHYRRRCMIRAPCCNEIYSCRHCHNEATSVMKHFYRHDLVRQDVKHVVCSVCDTEQPVAQVCTNCGVRMGEYFCDICKFFDDDTGKQQFHCDECGICRVGGQENFFHCNKCGSCYSIALRNNHSCVENSMRHHCPICYEYLFDSMKDTAVMKCGHTMHCECYDEMIYREKFCCPICSKSVIDMSREWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTTQVYFHIIGQKCGRCSSYNTRTIAPPVLTQ*
• ORF Type: complete

Annotations of Ll_transcript_49862

• Blastp: E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 71.72% of identity
• Blastx: E3 ubiquitin-protein ligase MIEL1 from Arabidopsis with 71.72% of identity
• Eggnog: ring finger and CHY zinc finger(ENOG410XXHF)
• Kegg: Link to kegg annotations (AT5G18650)
• CantataDB: Link to cantataDB annotations (CNT0000793)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418249.1)
• Pfam: CHY zinc finger (PF05495.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;