Protein coding transcript 256644

• Transcript: Ll_transcript_50369
• CDS coordinates: 2-352 (+)
• Peptide sequence: DHLPLPGITVGDIGMKFGNGAYNTMDNGVLRFDNVRIPRDQMLMRVSQVTREGKFVQSNVPRQLVYGTMVFVRQTIVAGASDALSRAVCIATRYSAVRRQFGSRNGGPETQVIDYKT
• ORF Type: internal

Annotations of Ll_transcript_50369

• Blastp: Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 82.05% of identity
• Blastx: Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 82.05% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (AT2G35690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421624.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;