Protein coding transcript 256653

• Transcript: Ll_transcript_50379
• CDS coordinates: 560-1246 (+)
• Peptide sequence: MFVPAIKGQGTEEQQQKWLPLAHKMQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHSPTLTSSKWWPGGLGKVSTHAVVYARLITDGQDHGVNGFIVQLRSLDDHLPLPGITIGDIGMKFGNGAYNTMDNGVLRFDNVRIPRDQMLMRVSQVTREGKLVQSKVPRQLVYGTMVYVRQTIVADASVAMSRAVCIATRYSAVRRQFGSHNGGPETQVSFRTLIDA*
• ORF Type: complete

Annotations of Ll_transcript_50379

• Blastp: Putative peroxisomal acyl-coenzyme A oxidase 1.2 from Arabidopsis with 86.36% of identity
• Blastx: Peroxisomal acyl-coenzyme A oxidase 1 from Arabidopsis with 81.59% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (AT2G35690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423731.1)
• Pfam: Acyl-coenzyme A oxidase N-terminal (PF14749.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;