Protein coding transcript 256712

• Transcript: Ll_transcript_49882
• CDS coordinates: 1-639 (+)
• Peptide sequence: DLTGYDLNVDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDNLIQGRFLGELTKQVFSDLEASKYQMAEYRLSIYGRKQSEWDQLASWIVNNELYSENVVWLIQLPRLYNVYKEMGIVTSFQNILDNIFVPLFEVTVDPNSHPQLHVFLKLVVGLDLVDDESKPERRPTKHMPTPAQWTNVFNPAFSYYVYYCYANLYTLNKVAVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_49882

• Blastp: AMP deaminase from Arabidopsis with 92.45% of identity
• Blastx: AMP deaminase from Arabidopsis with 92.45% of identity
• Eggnog: adenosine deaminase(COG1816)
• Kegg: Link to kegg annotations (AT2G38280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020971860.1)
• Pfam: Adenosine/AMP deaminase (PF00962.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;