Protein coding transcript 256720

• Transcript: Ll_transcript_49903
• CDS coordinates: 1-474 (+)
• Peptide sequence: DLTGYDLNVDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDNLIQGRFLGELTKQVFSDLEASKYQMAEYRISIYGRKQSEWDQLASWIVNNELYSENVVWLIQLPRLYNVYKEMGIVTSFQNILDNIFIPLFEVTVDPNSHPQLHVFLKLV
• ORF Type: internal

Annotations of Ll_transcript_49903

• Blastp: AMP deaminase from Arabidopsis with 94.94% of identity
• Blastx: AMP deaminase from Arabidopsis with 94.94% of identity
• Eggnog: adenosine deaminase(COG1816)
• Kegg: Link to kegg annotations (AT2G38280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413657.1)
• Pfam: Adenosine/AMP deaminase (PF00962.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;