Protein coding transcript 256744

• Transcript: Ll_transcript_52249
• CDS coordinates: 152-679 (+)
• Peptide sequence: MESCDTNTLAYNSSSSLPVTPQVVLSPCAACKILRRRCAEKCVLAPYFPPTEPAKFIIAHRVFGASNIIKFLQELQESERADAVSSMVYEASARIRDPIYGCAGTICHLQNQVNELEAQLAKAQAEIVNMQVQQTNLMSLICTEAAQSPQELSPQQSVDNFSEDNTMLLWEPLWA*
• ORF Type: complete

Annotations of Ll_transcript_52249

• Blastp: LOB domain-containing protein 1 from Arabidopsis with 68.94% of identity
• Blastx: LOB domain-containing protein 1 from Arabidopsis with 68.94% of identity
• Eggnog: lob domain-containing protein(ENOG410YHTF)
• Kegg: Link to kegg annotations (AT1G07900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450747.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;