Transcript | Ll_transcript_50011 |
---|---|
CDS coordinates | 182-1177 (+) |
Peptide sequence | MDESKNLLKLQCSVMNYDWGLKGCDSNVARLFSLNSRSEIDLHKPYAEFWMGTHDSGPSFLHDSSQSLTLKSWISQNPHVLGHNVLHKWGSDLPFLFKVLSVGKALSIQAHPDKELARTLHKLRPGLYKDGSHKPEMALAMTQFEALCGFITLKELKAVLHTVPEVSELIGAENANLVLQTSDQDSEEKLKSVLKAVFTLLMSANKDRITDAVNTLKCRLHKESEMRQLTDKEQLVLQLEKQYPADVGVIAAFFLNLVKLNPGEALFLGPNEPHAYLSGECVECMATSDNVVRAGLTPKHIDVQTLCSMLTYNQVNDTSYIKVVTVVRIGR* |
ORF Type | complete |
Blastp | Mannose-6-phosphate isomerase 1 from Arabidopsis with 66.01% of identity |
---|---|
Blastx | Mannose-6-phosphate isomerase 1 from Arabidopsis with 62.39% of identity |
Eggnog | mannose-6-phosphate isomerase(COG1482) |
Kegg | Link to kegg annotations (AT3G02570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418903.1) |
Pfam | Phosphomannose isomerase type I (PF01238.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer