Protein coding transcript 256813

• Transcript: Ll_transcript_50021
• CDS coordinates: 182-667 (+)
• Peptide sequence: MDESKNLLKLQCSVMNYDWGLKGCDSNVARLFSLNSRSEIDLHKPYAEFWMGTHDSGPSFLHDSSQSLTLKSWISQNPHVLGHNVLHKWGSDLPFLFKVLSVGKALSIQAHPDKELARTLHKLRPGLYKDGSHKPEMALAMTQFEALCGFITLKVLHSVHF*
• ORF Type: complete

Annotations of Ll_transcript_50021

• Blastp: Mannose-6-phosphate isomerase 1 from Arabidopsis with 65.33% of identity
• Blastx: Mannose-6-phosphate isomerase 1 from Arabidopsis with 65.97% of identity
• Eggnog: mannose-6-phosphate isomerase(COG1482)
• Kegg: Link to kegg annotations (AT3G02570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418903.1)
• Pfam: Phosphomannose isomerase type I (PF01238.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;