Protein coding transcript 256851

• Transcript: Ll_transcript_52213
• CDS coordinates: 1-624 (+)
• Peptide sequence: GTSMVIANGVVTPAMSVLSSVNGLKVGVDAIKQDEVVMISIAFLIILFSLQKYGTSKMGLFVGPALFIWFCSLAGIGIYNLVKYDSSVLRAFNPIYIYYFFARNSTKAWYSLGGCILCATGSEAMFADLCYFSVRSVQLTFVFLVLPCLMLGYLGQAAYLMENHADAGQAFFSSVPSGVFWPTLFIANIAALIASRAMTTATFSCIKQ
• ORF Type: internal

Annotations of Ll_transcript_52213

• Blastp: Potassium transporter 7 from Arabidopsis with 86.06% of identity
• Blastx: Potassium transporter 7 from Arabidopsis with 86.06% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (AT5G09400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426381.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;