Protein coding transcript 256855

• Transcript: Ll_transcript_52201
• CDS coordinates: 3-518 (+)
• Peptide sequence: KERLETSLTLKKILLLLVLAGTSMVIANGVVTPAMSVLSSVGGLKVGVDAIKQDEVVMISIAFLIILFSLQKYGTSKMGLFVGPALFIWFCSLAGIGIYNLVKYDSSVLRAFNPIYIYYFFARNSTKAWYSLGGCILCATGKQIFAGPLLWWMHHAIVYMSVFACVFVDFI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_52201

• Blastp: Potassium transporter 13 from Arabidopsis with 68.79% of identity
• Blastx: Potassium transporter 13 from Arabidopsis with 68.79% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (AT4G33530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426381.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;