| Transcript | Ll_transcript_50457 |
|---|---|
| CDS coordinates | 98-424 (+) |
| Peptide sequence | MGVFTFVLRNSGGEWIAKQHSGDIEASAASTFQLQRLLVQAALAVDSSGGVQSSFSTVSPTSAVFQVIVGGAAFVGGGVAAAAPAGAAPAAEAAAPAKKEEKDFQILR* |
| ORF Type | complete |
| Blastp | 60S acidic ribosomal protein P3 from Zea with 74.29% of identity |
|---|---|
| Blastx | 60S acidic ribosomal protein P3 from Zea with 73.53% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (542339) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435045.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer