Transcript | Ll_transcript_50461 |
---|---|
CDS coordinates | 98-427 (+) |
Peptide sequence | MGVFTFVLRNSGGEWIAKQHSGDIEASAASTFQLQRLLVQAALAVDSSGGVQSSFSTVSPTSAVFQVIVGGAAFVGGGVAAAAPAGAAPAAEAAAPAKKEEKVIWIVPI* |
ORF Type | complete |
Blastp | 60S acidic ribosomal protein P3 from Zea with 74.29% of identity |
---|---|
Blastx | 60S acidic ribosomal protein P3 from Zea with 73.53% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (542339) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435045.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer