Protein coding transcript 256888

• Transcript: Ll_transcript_51316
• CDS coordinates: 1-609 (+)
• Peptide sequence: SDKRALVESTIVAMGLQDCADTVIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASAFFVTQTLRALARDGRTVIASIHQPSSEVFELFDQLYLLSGGKTVYFGQASEAYEFFAQAGFPCPALRNPSDHFLRCVNSDFDKVKSTLKGSMKLRFEGSDDPIDKITTAEAIRTLLDFYRTSQQSYAARQKVDEIS
• ORF Type: internal

Annotations of Ll_transcript_51316

• Blastp: ABC transporter G family member 11 from Arabidopsis with 88.18% of identity
• Blastx: ABC transporter G family member 11 from Arabidopsis with 88.18% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT1G17840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443467.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;