Protein coding transcript 2569

• Transcript: Ll_transcript_301453
• CDS coordinates: 90-908 (+)
• Peptide sequence: MDQQHHHQPLFTFLETNNNNNPLLPTTTVPRRMFFSGDTEVDGDYANYVYWRPFVVLDMVWNLAFIIVAAGVLLTTLDERPNTPLRVWLCGYAIDCVIHMVFVYFQYSSLSPTPYRVLKKLEPVNTVASSVWWAIGFYWIVLGDQYLLEDSPRLYWLTVIFLAIDVFAIIFCIGLACIVFFALICSIPVIAVAFAMRVKEGASEEDIMSLPKYRFSQSNSLVMVDDQKQSSIGSCNGNLTSELSVHPDDSVSIVASHISSNIILMVLDDCMP*
• ORF Type: complete

Annotations of Ll_transcript_301453

• Blastp: E3 ubiquitin protein ligase RIE1 from Arabidopsis with 39.71% of identity
• Blastx: E3 ubiquitin protein ligase RIE1 from Arabidopsis with 39.71% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G01735)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458383.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;