Protein coding transcript 256905

• Transcript: Ll_transcript_49614
• CDS coordinates: 182-925 (+)
• Peptide sequence: MLGRALTSVLWGKIADRYGRKPVLVIGIIVVVIFNTLFGLSTSFWMAVITRLLLGSLCGVLGPVKAYATELFRVEHQAIGLSTVSAAWGIGLIIGPALGGYLAQPTEKYPHLFLKGSIWDKFPYFLPCLIISGFAFLVAIVCIWIPETLHNHNDRNKSIDDAEAIENGSIGEDKDRIIQKNESLLRNWPLMSAILAYSVFALHDVTYQEVSFLLNEVKNGLCSLFNITCLNFALPCFFLSIYASISE*
• ORF Type: complete

Annotations of Ll_transcript_49614

• Blastp: Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 59.43% of identity
• Blastx: Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 59.36% of identity
• Eggnog: Major Facilitator superfamily(ENOG410XSE0)
• Kegg: Link to kegg annotations (AT5G13750)
• CantataDB: Link to cantataDB annotations (CNT0001768)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465107.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;