Protein coding transcript 256917

• Transcript: Ll_transcript_49585
• CDS coordinates: 1-423 (+)
• Peptide sequence: MAAILIYSIYALHDIAYQEVSFHVNEVFSLWAVSPRRLGGLNYTTDDVGNVLSISGVALIIYQLTLYPSLEKACGPISIARISGVLSLPLLQIYPFIAMLSGLTLVIVINVASILKNLLCVSAPLSLSNHIVDIKYLKMK*
• ORF Type: complete

Annotations of Ll_transcript_49585

• Blastp: Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 52.46% of identity
• Blastx: Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 43.97% of identity
• Eggnog: Major Facilitator superfamily(ENOG410XSE0)
• Kegg: Link to kegg annotations (AT3G43790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434754.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;