Transcript | Ll_transcript_49586 |
---|---|
CDS coordinates | 401-757 (+) |
Peptide sequence | MLSGLTLVIVINVASILKNLLCATIITGLFLMQNRLVEQHQRGEANGIAMTCMSLFKAIGPATGGALLSWSQKRMDASFLPGTHMVFLVMNIVGALGIMMMFTSILREKKKISSNQQN* |
ORF Type | complete |
Blastp | Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 55.45% of identity |
---|---|
Blastx | Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 52.31% of identity |
Eggnog | Major Facilitator superfamily(ENOG410XSE0) |
Kegg | Link to kegg annotations (AT5G13750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434754.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer