Transcript | Ll_transcript_49593 |
---|---|
CDS coordinates | 889-1290 (+) |
Peptide sequence | MQVLSLPLLQIYPFIAMLSGLTLVIVINVASILKNLLCATIITGLFLMQNRLVEQHQRGEANGIAMTSMSLFTAIGPATGGALLSWSQTRMDASFLPGTHMVFFIINIISVVGLVSLIAFVRDKKKTSSDEQN* |
ORF Type | complete |
Blastp | Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 55.46% of identity |
---|---|
Blastx | Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 55.46% of identity |
Eggnog | Major Facilitator superfamily(ENOG410XSE0) |
Kegg | Link to kegg annotations (AT3G43790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451622.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer