Protein coding transcript 256921

• Transcript: Ll_transcript_49593
• CDS coordinates: 889-1290 (+)
• Peptide sequence: MQVLSLPLLQIYPFIAMLSGLTLVIVINVASILKNLLCATIITGLFLMQNRLVEQHQRGEANGIAMTSMSLFTAIGPATGGALLSWSQTRMDASFLPGTHMVFFIINIISVVGLVSLIAFVRDKKKTSSDEQN*
• ORF Type: complete

Annotations of Ll_transcript_49593

• Blastp: Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 55.46% of identity
• Blastx: Probable peptide/nitrate transporter At3g43790 from Arabidopsis with 55.46% of identity
• Eggnog: Major Facilitator superfamily(ENOG410XSE0)
• Kegg: Link to kegg annotations (AT3G43790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451622.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;