Protein coding transcript 256943

• Transcript: Ll_transcript_51341
• CDS coordinates: 3-857 (+)
• Peptide sequence: EGFFREMMEQGIEPNVVTYNVLLNGICRKASLHPEERFERTVKNAENLFDEMRKRGIEPDVTSFSIVLHVYSRAHKPQLSLDKLKLMKEKGICPTVVTYTSVIKCLCSCGRLEDAEGLLNEMVGSGVSPCAATYNCFFKEYRGRKDADSALKLFKKMKDDGVCLPTAQTYSILIAMLLKLNRIGVVKEIWNDMKGTRVGPDLDLYTVLIHGLCENQNWKEACHFFVEMIENGFLPQKVTFETLYRGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYPLKPYRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_51341

• Blastp: Pentatricopeptide repeat-containing protein At2g13420, mitochondrial from Arabidopsis with 71.83% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g13420, mitochondrial from Arabidopsis with 71.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431042.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;