Protein coding transcript 256966

• Transcript: Ll_transcript_51060
• CDS coordinates: 101-538 (+)
• Peptide sequence: MAATSTSLFFFSPSSSSSSSSSFRTYHNHSKFVSFSNSRHKSFTISASASVSVSNPTAPDALVLSILSKVIQTDGGVLLKNEEHKEVAEVAQELQKYCVDEPVKCPLIFGGVSYSSAQPLYYVLKVHRSYVPSGVSVPVPSQLEF*
• ORF Type: complete

Annotations of Ll_transcript_51060

• Blastp: Probable plastid-lipid-associated protein 8, chloroplastic from Arabidopsis with 44.26% of identity
• Blastx: Probable plastid-lipid-associated protein 8, chloroplastic from Arabidopsis with 74.19% of identity
• Eggnog: plastid-lipid-associated protein 8(ENOG4111J7K)
• Kegg: Link to kegg annotations (AT5G19940)
• CantataDB: Link to cantataDB annotations (CNT0001820)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457165.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;