Protein coding transcript 257038

• Transcript: Ll_transcript_51241
• CDS coordinates: 30-671 (+)
• Peptide sequence: MGWSILCFQLLVSSFILSTLFWNVVHANKKCYIAYLGAHSHGPTPSLLDLETATYSHYDLLASVIGSHEKAKEAIIYSYNRHINGFAALLEEEEADNLAKKPNIVSVFLSKEHKLHTTRSWEFLGLQRNAMNTAWQKGRYGVNTIIANIDTGVWPESKSFNDKGIGPVPAKWRGGKICQINKLHGSNKVPCNRCVNHRGLMTLKFALLKAIFI*
• ORF Type: complete

Annotations of Ll_transcript_51241

• Blastp: Subtilisin-like protease Glyma18g48580 from Soja with 73.06% of identity
• Blastx: Subtilisin-like protease Glyma18g48580 from Soja with 73.61% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002900)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451659.1)
• Pfam: Peptidase inhibitor I9 (PF05922.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;