Protein coding transcript 257041

• Transcript: Ll_transcript_51244
• CDS coordinates: 703-1269 (+)
• Peptide sequence: MHFFPATTRDNTKRPIRDAFDKTLATPFAYGSGHVQPDFAMDPGLVYDITIVDYLNFLCASGYNQKLIAALRNSKKPFICSKSHSTVTDLNYPSITLPNLGLSAVNVTRVVTNVGTPSTYVASVYLPGFKVVVVPNSLSFKKVGEKKIFQVVVQATRVIPRGNYQFGELQWTNNVNHVVKSPIVARRK*
• ORF Type: complete

Annotations of Ll_transcript_51244

• Blastp: Subtilisin-like protease Glyma18g48580 from Soja with 61.96% of identity
• Blastx: Subtilisin-like protease Glyma18g48580 from Soja with 61.96% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451659.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;