Protein coding transcript 257070

• Transcript: Ll_transcript_50793
• CDS coordinates: 132-797 (+)
• Peptide sequence: MHPSQRLECTWLTPFKFKTCPSPMNSNYATFPFITIIPSSNPKTLSFPKYPLSFFQPKKTHFPLKVKRTSFVIRASNDGNSQTASNWSKWIPTGSFAADQVFRLIAGATASPIGQFVSSPTTFLHSIDPRVKLVWLLALVVLPARSHIIMRFGLVIFLTLLSIWVLQRDVWKDQLGRVYFLSGLVFITLGLGADGVPSVVQLRTPPPALTGLPNFPVSLSG*
• ORF Type: complete

Annotations of Ll_transcript_50793

• Blastp: Protein ABCI12, chloroplastic from Arabidopsis with 52.79% of identity
• Blastx: Protein ABCI12, chloroplastic from Arabidopsis with 54.82% of identity
• Eggnog: Cobalt transport protein(COG0619)
• Kegg: Link to kegg annotations (AT3G21580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439763.1)
• Pfam: Cobalt transport protein (PF02361.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;