| Transcript | Ll_transcript_50781 |
|---|---|
| CDS coordinates | 1-402 (+) |
| Peptide sequence | KQPALTNFLGCREWLTVVAQSVLEETQRRMAKVWLLALVVLPARSHIIMRFGLVIFLTLLSIRILQRDVWKDQLGRVYFLSGLVFITLGLGADGVPSVVQLRTPPPALTGLPNFPVSLSAIICIAMVFAPYEIH |
| ORF Type | internal |
| Blastp | Protein ABCI12, chloroplastic from Arabidopsis with 50.89% of identity |
|---|---|
| Blastx | Protein ABCI12, chloroplastic from Arabidopsis with 50.89% of identity |
| Eggnog | Cobalt transport protein(COG0619) |
| Kegg | Link to kegg annotations (AT3G21580) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016197384.2) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer