Protein coding transcript 257141

• Transcript: Ll_transcript_38347
• CDS coordinates: 724-1050 (+)
• Peptide sequence: MVLHWFYLRLPSSVSHLVSNFRKRMCDNDPGVIDAALCPLFDLVAVDVDSYKDLVVSFVNILKQVVDRRLHKNYDYHQMPAPFIQVKLLKLLALLGSSDKKTSKNMEE*
• ORF Type: complete

Annotations of Ll_transcript_38347

• Blastp: AP-4 complex subunit epsilon from Arabidopsis with 73.58% of identity
• Blastx: AP-4 complex subunit epsilon from Arabidopsis with 67.86% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPKK)
• Kegg: Link to kegg annotations (AT1G31730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016201298.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;