Protein coding transcript 257143

• Transcript: Ll_transcript_38349
• CDS coordinates: 134-574 (+)
• Peptide sequence: MKRKTFELLYKMTKSSNVEVIVDRMIDYMISISDDHYKAYIASRCVELAEQFSPSNHWFIQTINKVFEHAGDLVNIKVAHNLMRLIAEGFGEGDDAAYSQLRSSAVESYLRIIGEPKLPSVFLQVICWVLGEYGTADGKYCASYISG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_38349

• Blastp: AP-4 complex subunit epsilon from Arabidopsis with 86.39% of identity
• Blastx: AP-4 complex subunit epsilon from Arabidopsis with 85.71% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPKK)
• Kegg: Link to kegg annotations (AT1G31730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445113.1)
• Pfam: Adaptin N terminal region (PF01602.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;