Protein coding transcript 257158

• Transcript: Ll_transcript_37896
• CDS coordinates: 334-1011 (+)
• Peptide sequence: MSHVLHQRPLQNPFSNPFSFSPPSSTNPKRPISLFTPTTLLALLLFIIVVGFLCPWVGLMPQNMIFSSVSKPYSVVSSKWGHYTLDKALNFVAKNGTVIVCIVSQPYLPFLNNWLISVTRQKRQDMVLVIAEDYASLDKVNEHWPGHAVLIPPVLDAENAHKFGSKGFFNFTARRPSHLLKILELGYNVMYNDVDMVWLADPLAKLEGNHDVYFSDDMTAVSFLI*
• ORF Type: complete

Annotations of Ll_transcript_37896

• Blastp: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase MGP4 from Arabidopsis with 67.12% of identity
• Blastx: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase MGP4 from Arabidopsis with 77.93% of identity
• Eggnog: BEST Arabidopsis thaliana protein match is RGXT1 (rhamnogalacturonan xylosyltransferase 1)(ENOG4111Z77)
• Kegg: Link to kegg annotations (AT4G01220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460054.1)
• Pfam: Nucleotide-diphospho-sugar transferase (PF03407.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;