Protein coding transcript 257175

• Transcript: Ll_transcript_38978
• CDS coordinates: 28-336 (+)
• Peptide sequence: MAVAHKDIKIYQQQRTCKDTEIDAGLVGHIHLDETMLKKLKINMDDVLQRCQERLNSFNRKKKVNQIFKRIELDSSESCYCTHPSAPCVKFLWPDGDHSDLDK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_38978

• Blastp: DNA-directed RNA polymerase V subunit 1 from Arabidopsis with 36.27% of identity
• Blastx: DNA-directed RNA polymerase V subunit 1 from Arabidopsis with 36.27% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0086)
• Kegg: Link to kegg annotations (AT2G40030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449375.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;