Protein coding transcript 257253

• Transcript: Ll_transcript_38281
• CDS coordinates: 2-469 (+)
• Peptide sequence: FSREEGIDVRKMMGHKRSHCSVDQSSYTSIASKRQKADVSITTKERKEKLGERIVALQQLVSPFGKTDTSSVLKEAMEYIGFLHQQVKVLSAPYLESSPKTAMQAMEPCSMRSRGLCLVPVSLTMGVADSNGADIWAPIKTTSPKFEKDGDSQFY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_38281

• Blastp: Transcription factor bHLH153 from Arabidopsis with 57.42% of identity
• Blastx: Transcription factor bHLH153 from Arabidopsis with 57.42% of identity
• Eggnog: ethylene-responsive protein(ENOG410YRG3)
• Kegg: Link to kegg annotations (AT1G05710)
• CantataDB: Link to cantataDB annotations (CNT0001291)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423987.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;