Transcript | Ll_transcript_38281 |
---|---|
CDS coordinates | 2-469 (+) |
Peptide sequence | FSREEGIDVRKMMGHKRSHCSVDQSSYTSIASKRQKADVSITTKERKEKLGERIVALQQLVSPFGKTDTSSVLKEAMEYIGFLHQQVKVLSAPYLESSPKTAMQAMEPCSMRSRGLCLVPVSLTMGVADSNGADIWAPIKTTSPKFEKDGDSQFY* |
ORF Type | 5prime_partial |
Blastp | Transcription factor bHLH153 from Arabidopsis with 57.42% of identity |
---|---|
Blastx | Transcription factor bHLH153 from Arabidopsis with 57.42% of identity |
Eggnog | ethylene-responsive protein(ENOG410YRG3) |
Kegg | Link to kegg annotations (AT1G05710) |
CantataDB | Link to cantataDB annotations (CNT0001291) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423987.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer