Protein coding transcript 257279

• Transcript: Ll_transcript_39758
• CDS coordinates: 206-985 (+)
• Peptide sequence: MKHSIDQFKGQTRLPNIAIPKRYELHLKPDLIACTFSGTVQINLNIIENTKFLVLNSLELVIQHSLFTNSHGQYAPCDVVVDDDDEIVVMVFEETLSVGEGVLRIEFSGVLNQHLTGLYKCTYVDGGVKKNMATTQFEAVDARRCFPCWDEPAMKATFKITLTVPSELIALSNMPVANEKLDGELKTVYFVESLIMSTYLVAVVVGLFDHIEYTTTAGIKVGVYCAVGKSDQAEFALDIAVKTLDIYTKLVLPSSFILR*
• ORF Type: complete

Annotations of Ll_transcript_39758

• Blastp: Aminopeptidase M1 from Arabidopsis with 57.03% of identity
• Blastx: Aminopeptidase M1 from Arabidopsis with 57.03% of identity
• Eggnog: aminopeptidase(COG0308)
• Kegg: Link to kegg annotations (AT4G33090)
• CantataDB: Link to cantataDB annotations (CNT0000134)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425220.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;