Protein coding transcript 257321

• Transcript: Ll_transcript_38326
• CDS coordinates: 1-606 (+)
• Peptide sequence: QLSIQSEVEQLPIQSNTEQLSIQSEVEQLPIQSNTEQLSIQSEVVDVPDPAAVAPPASKSSIRFPLRPGKGTFGHKCIVKANHFFAELPNKDLHQYDVTITPEVTSRGVNRAVMEQLVKLYRNSHLGKRLPAYDGRKSLYTAGPLPFVSKEFRVSLIDEDDGTGAQRFTSFMFITNCKLIVDFIFVYMIIFCVYILMQERKG
• ORF Type: internal

Annotations of Ll_transcript_38326

• Blastp: Protein argonaute 1 from Arabidopsis with 69.7% of identity
• Blastx: Protein argonaute 1 from Arabidopsis with 77.27% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (AT1G48410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431391.1)
• Pfam: N-terminal domain of argonaute (PF16486.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;