Protein coding transcript 257335

• Transcript: Ll_transcript_38316
• CDS coordinates: 2198-3565 (+)
• Peptide sequence: MVNGGTVNHWFCINFARNVQDSVARGFCFELAQMCQISGMAFNPDPVVPALSARPDQVEKVLKNRHSDAKSRLKGQDLDLLIVILPDNNGSLYGDLKRICETDLGVVSQCCLTKHVFKMSKQYLANVALKINVKVGGRNTVLVDALSRRIPLVSDRPTIIFGADVTHPHPGEDSSPSIAAVVASQDWPEITKYAGLVCAQAHRQELIQDLFKQWQDPVRGTVTGGMVKELLISFRRATGQKPTRIIFYRDGVSEGQFYQVLLFELDAIRKACASLEPNYQPPVTFVVVQKRHHTRLFANNHNDRGSIDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRPAHYHVLWDENNFSADGLQTLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMEPETSDSGSMASGAYAANRGMGGSATRSTRAPGLNAAVRPLPALRDNVKKVMFYC*
• ORF Type: complete

Annotations of Ll_transcript_38316

• Blastp: Protein argonaute 1 from Arabidopsis with 86.4% of identity
• Blastx: Protein argonaute 1 from Arabidopsis with 86.24% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (AT1G48410)
• CantataDB: Link to cantataDB annotations (CNT0002515)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458185.1)
• Pfam: Piwi domain (PF02171.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;