Transcript | Ll_transcript_37479 |
---|---|
CDS coordinates | 204-1139 (+) |
Peptide sequence | MRFLLFLLLLHFYHTFSHSKPISQYRALLSLKSSFIDSTPPVLSSWNTSTDHCSFSGVTCDNHRHVISLNLAGLGLSGTLSGDVAYLPFLSNLSLADNKFYGSVPPQLSALSGLRFLNLSNNFFNGTFPSELSVLKNLEVLDLYNNNMTGELPLAVTGMVNLRHLHLGGNFFSGQIPPEYGRWQRINYLAVSGNELEGTIPPEIGNLASLRELYIGYYNTYAGGIPPEIGNLSELVRLDAAYCGLSGEIPAEIGKLQKLDTLFLQVNALSGTLTPELGKLKSLKSMDLSNNMLYGEIPESFKELKNITLLNL |
ORF Type | 3prime_partial |
Blastp | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 from Arabidopsis with 69.18% of identity |
---|---|
Blastx | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 from Arabidopsis with 69.18% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G49670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421457.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer