Protein coding transcript 257385

• Transcript: Ll_transcript_37470
• CDS coordinates: 214-1149 (+)
• Peptide sequence: MRFLLFLLLLHFYHTFSHSKPISQYRALLSLKSSFIDSTPPVLSSWNTSTDHCSFSGVTCDNHRHVISLNLAGLGLSGTLSGDVAYLPFLSNLSLADNKFYGSVPPQLSALSGLRFLNLSNNFFNGTFPSELSVLKNLEVLDLYNNNMTGELPLAVTGMVNLRHLHLGGNFFSGQIPPEYGRWQRINYLAVSGNELEGTIPPEIGNLASLRELYIGYYNTYAGGIPPEIGNLSELVRLDAAYCGLSGEIPAEIGKLQKLDTLFLQVNALSGTLTPELGKLKSLKSMDLSNNMLYGEIPESFKELKNITLLNL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_37470

• Blastp: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 from Arabidopsis with 69.18% of identity
• Blastx: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 from Arabidopsis with 69.18% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G49670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421457.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;