Protein coding transcript 257408

• Transcript: Ll_transcript_37987
• CDS coordinates: 1224-1832 (+)
• Peptide sequence: MKIIEEELGSPLESFFSYISEDPIAAASFGQVYFARTIDGIDVAVKVQRPNLRHVVVRDIYILRLGLGLLHNIANRKSDPRVYADELGKGFVGELDYTLEAANASKFQEVHSPFSFIRVPKIYPQLSRKRVLTMEWMVGESPTDLLSLSTGNSIGNVSEYSEKQKVDAKKRLLDLVCKQKKHLSILYILNVRNILTITVGAN*
• ORF Type: complete

Annotations of Ll_transcript_37987

• Blastp: Protein ACTIVITY OF BC1 COMPLEX KINASE 1, chloroplastic from Arabidopsis with 43.54% of identity
• Blastx: Rhomboid-like protein 19 from Arabidopsis with 54.11% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT4G31390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427497.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;