Protein coding transcript 257429

• Transcript: Ll_transcript_37989
• CDS coordinates: 2-646 (+)
• Peptide sequence: EFLKFIFVVNFLTSVCLFITAIALYYISRQEIYLYMPLSGFHGVISGFLVGIKQIIPDQELPLIKIKTKWLPSIAILLCVAISFWRLEAAAYLPTIISGTYISWIYLRYWQTKPETKLRGDPSEDFAFSTFFPEFLRPVIDPIASIFHRILCGRSDASNDAHGYTLGSEALPGSDSIEASRRRERGARALEERLAAERLAAARSELQRDASENV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_37989

• Blastp: Rhomboid-like protein 19 from Arabidopsis with 71.3% of identity
• Blastx: Rhomboid-like protein 19 from Arabidopsis with 71.59% of identity
• Eggnog: Transmembrane protein 115(ENOG410XQM0)
• Kegg: Link to kegg annotations (AT3G07950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414103.1)
• Pfam: Eukaryotic integral membrane protein (DUF1751) (PF08551.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;