Protein coding transcript 257458

• Transcript: Ll_transcript_38118
• CDS coordinates: 222-848 (+)
• Peptide sequence: MPGITAFAGIYEVGSPKKGECVFISAASGAVGQLAGQFAKLLGCYVVGSAGSQEKVDLLKNKLGFDDAFNYKEEPALDAALKRCFPNGIDLYFEQVGGKMLDAVLLNMKIHGRIIICGMISQYNISEPEPLKNIMQVAFKRLSIKGFTHRDHHHLYPKLLETVLPYIREKKIVYVEDIVEGIENGPEALVGLFSGRNFGKQIVAVAHE*
• ORF Type: complete

Annotations of Ll_transcript_38118

• Blastp: NADP-dependent alkenal double bond reductase P2 from Arabidopsis with 68.75% of identity
• Blastx: NADP-dependent alkenal double bond reductase P2 from Arabidopsis with 68.57% of identity
• Eggnog: alcohol dehydrogenase(COG2130)
• Kegg: Link to kegg annotations (AT5G16990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421610.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;